PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00403.1.p
Common NameEUGRSUZ_F00403, LOC104448012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 331aa    MW: 35571.4 Da    PI: 7.568
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00403.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.46.4e-32126180358
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       +vrY+eClkNhA+ +Gg avDGCgEfm++ geegt +alkCaAC+CHRnFHR+e++
  Eucgr.F00403.1.p 126 SVRYRECLKNHAVGIGGSAVDGCGEFMAA-GEEGTLDALKCAACNCHRNFHRKETD 180
                       79**************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.9E-29127179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.6E-29128178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-23128181IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.874129178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.46E-21253328IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-32254329IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-27267323IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MMATLSIPSY LLFSSVLGGS LHSSEKTHVK ISATATPAAA TISSWREKGN WRREGERERG  60
REEREDMEFD EHDDQDEEME IPVHHHQAAP APVGYDSLGN PGRPSGSGAV GEGGASAAPR  120
KSASASVRYR ECLKNHAVGI GGSAVDGCGE FMAAGEEGTL DALKCAACNC HRNFHRKETD  180
AGDGGGGLVS YHHPHHHPGQ QHPQFSPYYR AAPSPAGYLH LTPPQQQHRP LALPAASGGG  240
HSREELEDMS NPSSSGGGGG GGGSGLKKRF RTKFTPEQKE KMLGFAERLG WRIQKHDETA  300
VEQFCAETGV KRHVLKVWMH NNKHTLGKKP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-292683251875ZF-HD homeobox family protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00403.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060081.10.0PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
SwissprotQ6YXH51e-78ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A059BKP60.0A0A059BKP6_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s17620.19e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45052454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-70homeobox protein 22